PDB entry 3qx7

View 3qx7 on RCSB PDB site
Description: Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with phosphate, a closed cap conformation
Class: hydrolase
Keywords: HYDROLASE, PYROPHOSPHATASE, MAGNESIUM BI NEW YORK SGX RESEARCH CENTER FOR STRUCTURAL GENOMICS, ENZYME FUNCTION INITIATIVE, EFI, PSI-2, Protein Structure Initiative, NYSGXRC
Deposited on 2011-03-01, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2127
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A5V9 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d3qx7a1, d3qx7a2
  • Heterogens: PO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qx7A (A:)
    gsshhhhhhssglvprgshmrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsre
    eaymhegrtgastinivfqrelgkeatqeeiesiyheksilfnsypeaermpgawellqk
    vksegltpmvvtgsgqlsllerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgg
    lkadeavvienaplgveaghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdt
    iml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qx7A (A:)
    hmrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivf
    qrelgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqls
    llerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgvea
    ghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdtim