PDB entry 3qwz

View 3qwz on RCSB PDB site
Description: Crystal structure of FAF1 UBX-p97N-domain complex
Class: transport protein
Keywords: UBX, p97 Binding, TRANSPORT PROTEIN
Deposited on 2011-02-28, released 2012-05-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3qwza1, d3qwza2
  • Chain 'B':
    Compound: fas-associated factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FAF1, UBXD12, UBXN3A, CGI-03
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNN5 (4-83)
      • expression tag (3)
    Domains in SCOPe 2.05: d3qwzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qwzA (A:)
    gshmasgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtv
    llkgkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvl
    piddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspyciva
    pdtvihcegepikredeeeslnevgyddigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwzA (A:)
    pnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdeki
    rmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyflea
    yrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeesln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qwzB (B:)
    gshmepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtq
    ldpnksllevklfpqetlfleake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwzB (B:)
    mepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldp
    nksllevklfpqetlfleake