PDB entry 3qwf

View 3qwf on RCSB PDB site
Description: Crystal structure of the 17beta-hydroxysteroid dehydrogenase from Cochliobolus lunatus
Class: oxidoreductase
Keywords: HYDROXYSTEROID DEHYDROGENASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE, SDR STEROID, FUNGI, COCHLIOBOLUS LUNATUS, Rossmann Fold, Cytosol, OXIDOREDUCTASE
Deposited on 2011-02-28, released 2012-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.167
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qwfa_
  • Chain 'B':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qwfb_
  • Chain 'C':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qwfc_
  • Chain 'D':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qwfd_
  • Chain 'E':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qwfe_
  • Chain 'F':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qwff_
  • Chain 'G':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qwfg_
  • Chain 'H':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qwfh_
  • Heterogens: GOL, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qwfA (A:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwfA (A:)
    tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
    aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
    gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
    itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
    lvskegewvngkvltldggaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qwfB (B:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwfB (B:)
    tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
    aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
    gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
    itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
    lvskegewvngkvltldggaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qwfC (C:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwfC (C:)
    tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
    aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
    gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
    itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
    lvskegewvngkvltldggaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qwfD (D:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwfD (D:)
    tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
    aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
    gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
    itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
    lvskegewvngkvltldggaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qwfE (E:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwfE (E:)
    tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
    aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
    gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
    itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
    lvskegewvngkvltldggaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3qwfF (F:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwfF (F:)
    tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
    aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
    gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
    itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
    lvskegewvngkvltldggaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3qwfG (G:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwfG (G:)
    tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
    aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
    gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
    itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
    lvskegewvngkvltldggaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3qwfH (H:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwfH (H:)
    tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
    aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
    gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
    itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
    lvskegewvngkvltldggaa