PDB entry 3qw0

View 3qw0 on RCSB PDB site
Description: Crystal structure of the Zn-RIDC1 complex stabilized by BMB crosslinks
Class: oxidoreductase
Keywords: Four-helix bundle, OXIDOREDUCTASE
Deposited on 2011-02-26, released 2011-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.194
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome cb562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QW0 (0-105)
    Domains in SCOPe 2.08: d3qw0a_
  • Chain 'B':
    Compound: Cytochrome cb562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QW0 (0-105)
    Domains in SCOPe 2.08: d3qw0b_
  • Chain 'C':
    Compound: Cytochrome cb562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QW0 (0-105)
    Domains in SCOPe 2.08: d3qw0c_
  • Chain 'D':
    Compound: Cytochrome cb562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QW0 (0-105)
    Domains in SCOPe 2.08: d3qw0d_
  • Heterogens: HEM, ME9, ZN, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3qw0A (A:)
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3qw0B (B:)
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3qw0C (C:)
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3qw0D (D:)
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr