PDB entry 3qvy

View 3qvy on RCSB PDB site
Description: Crystal structure of the Zn-RIDC1 complex stabilized by BMOE crosslinks
Class: oxidoreductase
Keywords: Four-helix bundle, Oxidoreductase
Deposited on 2011-02-26, released 2011-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.245
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome cb562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QVY (0-105)
    Domains in SCOPe 2.08: d3qvya_
  • Chain 'B':
    Compound: Cytochrome cb562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QVY (0-105)
    Domains in SCOPe 2.08: d3qvyb_
  • Chain 'C':
    Compound: Cytochrome cb562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QVY (0-105)
    Domains in SCOPe 2.08: d3qvyc_
  • Chain 'D':
    Compound: Cytochrome cb562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QVY (0-105)
    Domains in SCOPe 2.08: d3qvyd_
  • Heterogens: HEM, ZN, ME7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvyA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvyB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvyC (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvyD (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr