PDB entry 3qvv

View 3qvv on RCSB PDB site
Description: Crystal structure of Ancestral variant b9 of SULT 1A1 in complex with PAP and 3-CyC
Class: transferase
Keywords: Transferase, aryl sulfotransferase
Deposited on 2011-02-26, released 2011-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.232
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfotransferase 1A1
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1A1, STP, STP1, OK/SW-cl.88
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50225 (Start-294)
      • engineered mutation (9)
      • engineered mutation (76)
      • engineered mutation (150)
      • engineered mutation (167)
      • variant (212)
      • variant (222)
      • engineered mutation (242)
      • engineered mutation (246)
    Domains in SCOPe 2.08: d3qvva_
  • Chain 'B':
    Compound: Sulfotransferase 1A1
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1A1, STP, STP1, OK/SW-cl.88
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50225 (Start-294)
      • engineered mutation (9)
      • engineered mutation (76)
      • engineered mutation (150)
      • engineered mutation (167)
      • variant (212)
      • variant (222)
      • engineered mutation (242)
      • engineered mutation (246)
    Domains in SCOPe 2.08: d3qvvb_
  • Heterogens: A3P, 3QV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qvvA (A:)
    meliqdtsrqpleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildm
    iyqggdlekchrapifnrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlld
    qkvkvvyvarnakdvavsyyhfyhmakvhpdpgtwdsflekfmvgevcygswyqhvqeww
    elsrthpvlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtny
    ttipqeimdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qvvA (A:)
    srqpleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
    ekchrapifnrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
    varnakdvavsyyhfyhmakvhpdpgtwdsflekfmvgevcygswyqhvqewwelsrthp
    vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttipqei
    mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qvvB (B:)
    meliqdtsrqpleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildm
    iyqggdlekchrapifnrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlld
    qkvkvvyvarnakdvavsyyhfyhmakvhpdpgtwdsflekfmvgevcygswyqhvqeww
    elsrthpvlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtny
    ttipqeimdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qvvB (B:)
    srqpleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
    ekchrapifnrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
    varnakdvavsyyhfyhmakvhpdpgtwdsflekfmvgevcygswyqhvqewwelsrthp
    vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttipqei
    mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel