PDB entry 3qvt

View 3qvt on RCSB PDB site
Description: L-myo-inositol 1-phosphate synthase from Archaeoglobus fulgidus wild-type with the intermediate 5-keto 1-phospho glucose
Class: isomerase
Keywords: L-myo-inositol 1-phosphate synthase, ISOMERASE
Deposited on 2011-02-25, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myo-inositol-1-phosphate synthase (Ino1)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1794, AF_1794
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvta1, d3qvta2
  • Heterogens: PO4, NAI, PG4, KPG, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qvtA (A:)
    mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
    lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
    lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
    asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgktgetlvkttlapm
    fayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlgyspysiteiqyfp
    slvdnktafdfvhfkgflgklmkfyfiwdaidaivaaplildiarfllfakkkgvkgvvk
    emafffkspmdtnvintheqfvvlkewysnlk