PDB entry 3qvr

View 3qvr on RCSB PDB site
Description: Crystal structure of glucose oxidase for space group P3121 at 1.3 A resolution.
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2011-02-25, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.18
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose oxidase
    Species: Aspergillus niger [TaxId:5061]
    Gene: gox
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvra1, d3qvra2
  • Heterogens: NAG, FAD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qvrA (A:)
    sngieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgp
    iiedlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvd
    swetvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgd
    dyspivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrp
    nlqvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptiley
    sgigmksileplgidtvvdlpvglnlqdqttatvrsritsagagqgqaawfatfnetfgd
    ysekahellntkleqwaeeavarggfhnttalliqyenyrdwivnhnvayselfldtagv
    asfdvwdllpftrgyvhildkdpylhhfaydpqyflneldllgqaaatqlarnisnsgam
    qtyfagetipgdnlaydadlsawteyipyhfrpnyhgvgtcsmmpkemggvvdnaarvyg
    vqglrvidgsipptqmsshvmtvfyamalkisdailedyasmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qvrA (A:)
    gieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgpii
    edlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvdsw
    etvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgddy
    spivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrpnl
    qvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptileysg
    igmksileplgidtvvdlpvglnlqdqttatvrsritsagagqgqaawfatfnetfgdys
    ekahellntkleqwaeeavarggfhnttalliqyenyrdwivnhnvayselfldtagvas
    fdvwdllpftrgyvhildkdpylhhfaydpqyflneldllgqaaatqlarnisnsgamqt
    yfagetipgdnlaydadlsawteyipyhfrpnyhgvgtcsmmpkemggvvdnaarvygvq
    glrvidgsipptqmsshvmtvfyamalkisdailedyasmq