PDB entry 3qvq

View 3qvq on RCSB PDB site
Description: The structure of an Oleispira antarctica phosphodiesterase OLEI02445 in complex with the product sn-glycerol-3-phosphate
Class: hydrolase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, alpha-beta hydrolase, hydrolase
Deposited on 2011-02-25, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphodiesterase Olei02445
    Species: Oleispira antarctica [TaxId:188908]
    Gene: OLEI02445
    Database cross-references and differences (RAF-indexed):
    • PDB 3QVQ (0-End)
    Domains in SCOPe 2.07: d3qvqa_
  • Chain 'B':
    Compound: Phosphodiesterase Olei02445
    Species: Oleispira antarctica [TaxId:188908]
    Gene: OLEI02445
    Database cross-references and differences (RAF-indexed):
    • PDB 3QVQ (0-End)
    Domains in SCOPe 2.07: d3qvqb_
  • Chain 'C':
    Compound: Phosphodiesterase Olei02445
    Species: Oleispira antarctica [TaxId:188908]
    Gene: OLEI02445
    Database cross-references and differences (RAF-indexed):
    • PDB 3QVQ (Start-251)
    Domains in SCOPe 2.07: d3qvqc_
  • Chain 'D':
    Compound: Phosphodiesterase Olei02445
    Species: Oleispira antarctica [TaxId:188908]
    Gene: OLEI02445
    Database cross-references and differences (RAF-indexed):
    • PDB 3QVQ
    Domains in SCOPe 2.07: d3qvqd_
  • Heterogens: G3P, MG, NA, CL, PEG, EDO, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qvqA (A:)
    gmqsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddy
    lsrttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkp
    cegleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawq
    erlehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdyp
    qkiqsaidshin
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qvqA (A:)
    gmqsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddy
    lsrttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkp
    cegleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawq
    erlehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdyp
    qkiqsaidshi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qvqB (B:)
    gmqsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddy
    lsrttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkp
    cegleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawq
    erlehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdyp
    qkiqsaidshin
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qvqB (B:)
    gmqsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddy
    lsrttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkp
    cegleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawq
    erlehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdyp
    qkiqsaidsh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qvqC (C:)
    gmqsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddy
    lsrttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkp
    cegleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawq
    erlehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdyp
    qkiqsaidshin
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qvqC (C:)
    qsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddyls
    rttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkpce
    gleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawqer
    lehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdypqk
    iqsaidshin
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qvqD (D:)
    gmqsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddy
    lsrttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkp
    cegleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawq
    erlehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdyp
    qkiqsaidshin
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qvqD (D:)
    qsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddyls
    rttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkpce
    gleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawqer
    lehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdypqk
    iqsaids