PDB entry 3qv7

View 3qv7 on RCSB PDB site
Description: Crystal structure of Leishmania mexicana pyruvate kinase(LmPYK)in complex with ponceau S and acid blue 25.
Class: transferase/transferase inhibitor
Keywords: PYRUVATE KINASE, GLYCOLYSIS, TIM Barrel, Sugar kinase, ADP/ATP binding, cytosol, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-02-25, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PKY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qv7a1, d3qv7a2, d3qv7a3
  • Chain 'B':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PKY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qv7b1, d3qv7b2
  • Chain 'C':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PKY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qv7c1, d3qv7c2
  • Chain 'D':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PKY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qv7d1, d3qv7d2, d3qv7d3
  • Heterogens: SO4, K, QV7, QV8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qv7A (A:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qv7A (A:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    agyanqtrillve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qv7B (B:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qv7B (B:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgplpavsakdrvdlqfgveqgvdmifasfirsaeq
    vgdvrkalgpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvvaq
    kiliskcnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakgky
    pnevvqymaricleaqsalneyvffnsikklqhipmsadeavcssavnsvyetkakamvv
    lsntgrsarlvakyrpncpivcvttrlqtcrqlnitqgvesvffdadklghdegkehrva
    agvefakskgyvqtgdycvvihadhkvkgyanqtrillve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qv7C (C:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qv7C (C:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpvdlpavsakdrvdlqfgveqgvdmifasfirsa
    eqvgdvrkalgpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvv
    aqkiliskcnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakg
    kypnevvqymaricleaqsalneyvffnsikklqhipmsadeavcssavnsvyetkakam
    vvlsntgrsarlvakyrpncpivcvttrlqtcrqlnitqgvesvffdadklghdegkehr
    vaagvefakskgyvqtgdycvvihadgyanqtrillve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qv7D (D:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qv7D (D:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adgyanqtrillve