PDB entry 3qut

View 3qut on RCSB PDB site
Description: Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant, an open cap conformation
Class: hydrolase
Keywords: hydrolase, pyrophosphatase, magnesium binding site, new york sgx research center for structural genomics, nysgx enzyme function initiative, efi, psi-2, protein structure initiative, nysgxrc
Deposited on 2011-02-24, released 2011-04-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.145
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2127
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A5V9 (19-242)
      • expression tag (18)
      • engineered mutation (31)
    Domains in SCOPe 2.03: d3quta_
  • Heterogens: MG, MLT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qutA (A:)
    gsshhhhhhssglvprgshmrkklkavlfdmngvlfnsmpyhseawhqvmkthgldlsre
    eaymhegrtgastinivfqrelgkeatqeeiesiyheksilfnsypeaermpgawellqk
    vksegltpmvvtgsgqlsllerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgg
    lkadeavvienaplgveaghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdt
    iml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qutA (A:)
    hmrkklkavlfdmngvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivf
    qrelgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqls
    llerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgvea
    ghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdtiml