PDB entry 3qup

View 3qup on RCSB PDB site
Description: Inhibitor bound structure of the kinase domain of the murine receptor tyrosine kinase TYRO3 (Sky)
Class: Transferase/transferase inhibitor
Keywords: protein kinase inhibitor, receptor tyrosine kinase, spirocycle, Kinase domain, Phosphotransfer, Gas6 ligand, Cytoplasmic surface, Transferase-transferase inhibitor complex
Deposited on 2011-02-24, released 2011-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.239
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase receptor TYRO3
    Species: Mus musculus [TaxId:10090]
    Gene: Tyro3, Dtk, Rse
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qupa_
  • Heterogens: LUN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qupA (A:)
    mldslgisdelkekledvlipeqqftlgrmlgkgefgsvreaqlkqedgsfvkvavkmlk
    adiiassdieeflreaacmkefdhphvaklvgvslrsrakgrlpipmvilpfmkhgdlha
    fllasrigenpfnlplqtlvrfmvdiacgmeylssrnfihrdlaarncmlaedmtvcvad
    fglsrkiysgdyyrqgcasklpvkwlalesladnlytvhsdvwafgvtmweimtrgqtpy
    agienaeiynyliggnrlkqppecmeevydlmyqcwsadpkqrpsftclrmelenilghl
    svlstsqdplyinierahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qupA (A:)
    edvlipftlgrmlgkgefgsvreaqlvkvavkmlssdieeflreaacmkefdhphvaklv
    gvslrsipmvilpfmkhgdlhafllasripfnlplqtlvrfmvdiacgmeylssrnfihr
    dlaarncmlaedmtvcvadfgllpvkwlalesladnlytvhsdvwafgvtmweimtrgqt
    pyagienaeiynyliggnrlkqppecmeevydlmyqcwsadpkqrpsftclrmelenilg
    h