PDB entry 3qu7

View 3qu7 on RCSB PDB site
Description: Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with calcium and phosphate
Class: hydrolase
Keywords: HYDROLASE, PYROPHOSPHATASE, MAGNESIUM BINDING SITE, NEW YORK SGX RESEARCH CENTER FOR STRUCTURAL GENOMICS, ENZYME FUNCTION INITIATIVE, EFI, PSI-2, Protein Structure Initiative, NYSGXRC
Deposited on 2011-02-23, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2127
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A5V9 (Start-242)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d3qu7a_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2127
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A5V9 (19-242)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d3qu7b_
  • Heterogens: PO4, CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qu7A (A:)
    gsshhhhhhssglvprgshmrkklkavlfdmngvlfnsmpyhseawhqvmkthgldlsre
    eaymhegrtgastinivfqrelgkeatqeeiesiyheksilfnsypeaermpgawellqk
    vksegltpmvvtgsgqlsllerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgg
    lkadeavvienaplgveaghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdt
    iml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qu7A (A:)
    klkavlfdmngvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqrel
    gkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsller
    lehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveaghka
    giftiavntgpldgqvlldagadllfpsmqtlcdswdtiml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qu7B (B:)
    gsshhhhhhssglvprgshmrkklkavlfdmngvlfnsmpyhseawhqvmkthgldlsre
    eaymhegrtgastinivfqrelgkeatqeeiesiyheksilfnsypeaermpgawellqk
    vksegltpmvvtgsgqlsllerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgg
    lkadeavvienaplgveaghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdt
    iml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qu7B (B:)
    mrkklkavlfdmngvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfq
    relgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsl
    lerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveag
    hkagiftiavntgpldgqvlldagadllfpsmqtlcdswdtiml