PDB entry 3qu2

View 3qu2 on RCSB PDB site
Description: Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation
Class: hydrolase
Keywords: HYDROLASE, PYROPHOSPHATASE,MAGNESIUM BINDING SITE, NEW YORK SGX RESEARCH CENTER FOR STRUCTURAL GENOMICS, NYSGXRC, ENZYME FUNCTION INITIATIVE, EFI, PSI-2, Protein Structure Initiative
Deposited on 2011-02-23, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.234
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2127
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qu2a_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2127
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qu2b_
  • Chain 'C':
    Compound: inorganic pyrophosphatase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2127
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qu2c_
  • Chain 'D':
    Compound: inorganic pyrophosphatase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2127
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qu2d_
  • Heterogens: MG, GOL, CIT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qu2A (A:)
    gsshhhhhhssglvprgshmrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsre
    eaymhegrtgastinivfqrelgkeatqeeiesiyheksilfnsypeaermpgawellqk
    vksegltpmvvtgsgqlsllerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgg
    lkadeavvienaplgveaghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdt
    iml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qu2A (A:)
    klkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqrel
    gkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsller
    lehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveaghka
    giftiavntgpldgqvlldagadllfpsmqtlcdswdtiml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qu2B (B:)
    gsshhhhhhssglvprgshmrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsre
    eaymhegrtgastinivfqrelgkeatqeeiesiyheksilfnsypeaermpgawellqk
    vksegltpmvvtgsgqlsllerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgg
    lkadeavvienaplgveaghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdt
    iml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qu2B (B:)
    klkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqrel
    gkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsller
    lehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveaghka
    giftiavntgpldgqvlldagadllfpsmqtlcdswdtiml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qu2C (C:)
    gsshhhhhhssglvprgshmrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsre
    eaymhegrtgastinivfqrelgkeatqeeiesiyheksilfnsypeaermpgawellqk
    vksegltpmvvtgsgqlsllerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgg
    lkadeavvienaplgveaghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdt
    iml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qu2C (C:)
    klkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqrel
    gkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsller
    lehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveaghka
    giftiavntgpldgqvlldagadllfpsmqtlcdswdtiml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qu2D (D:)
    gsshhhhhhssglvprgshmrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsre
    eaymhegrtgastinivfqrelgkeatqeeiesiyheksilfnsypeaermpgawellqk
    vksegltpmvvtgsgqlsllerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgg
    lkadeavvienaplgveaghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdt
    iml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qu2D (D:)
    klkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqrel
    gkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsller
    lehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveaghka
    giftiavntgpldgqvlldagadllfpsmqtlcdswdtiml