PDB entry 3qti

View 3qti on RCSB PDB site
Description: c-Met Kinase in Complex with NVP-BVU972
Class: transferase/transferase inhibitor
Keywords: kinase, TRANSERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-02-22, released 2011-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-313)
      • engineered mutation (147)
      • engineered mutation (187)
    Domains in SCOPe 2.06: d3qtia_
  • Chain 'B':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-313)
      • engineered mutation (147)
      • engineered mutation (187)
    Domains in SCOPe 2.06: d3qtib_
  • Heterogens: 3QT, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qtiA (A:)
    gpgtvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qtiA (A:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldkihcavkslnri
    tdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethn
    ptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydkefl
    pvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdfditvyllqgrrllqpeyc
    pdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qtiB (B:)
    gpgtvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qtiB (B:)
    lnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkkihcavkslnritdigev
    sqfltegiimkdfshpnvlsllgiclplvvlpymkhgdlrnfirnethnptvkdligfgl
    qvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydkeflpvkwmaleslq
    tqkfttksdvwsfgvllwelmtrgappypfditvyllqgrrllqpeycpdplyevmlkcw
    hpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk