PDB entry 3qt4

View 3qt4 on RCSB PDB site
Description: Structure of digestive procathepsin L 3 of Tenebrio molitor larval midgut
Class: hydrolase
Keywords: hydrolase, cysteine proteinase, zymogen, intramolecular dissulphide bonds, insect larval midgut
Deposited on 2011-02-22, released 2012-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin-L-like midgut cysteine proteinase
    Species: Tenebrio molitor [TaxId:7067]
    Gene: pCAL3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7YXL2 (Start-328)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d3qt4a_
  • Heterogens: PO4, PG4, PG6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qt4A (A:)
    mhhhhhhlegsdleicslpkslfqeqwsqfklthkksysspieeirrqlifkdnvakiae
    hnakfekgevtyskamnqfgdmskeeflayvnrgkaqkpkhpenlrmpyvsskkplaasv
    dwrsnavsevkdqgqcgsswsfsttgavegqlalqrgrltslseqnlidcsssygnagcd
    ggwmdsafsyihdygimsesaypyeaqgdycrfdssqsvttlsgyydlpsgdensladav
    gqagpvavaidatdelqfysgglfydqtcnqsdlnhgvlvvgygsdngqdywilknswgs
    gwgesgywrqvrnygnncgiataasypal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qt4A (A:)
    kslfqeqwsqfklthkksysspieeirrqlifkdnvakiaehnakfekgevtyskamnqf
    gdmskeeflayvnrgkaqnlrmpyvsskkplaasvdwrsnavsevkdqgqcgsswsfstt
    gavegqlalqrgrltslseqnlidcsssygnagcdggwmdsafsyihdygimsesaypye
    aqgdycrfdssqsvttlsgyydlpsgdensladavgqagpvavaidatdelqfysgglfy
    dqtcnqsdlnhgvlvvgygsdngqdywilknswgsgwgesgywrqvrnygnncgiataas
    ypal