PDB entry 3qt3

View 3qt3 on RCSB PDB site
Description: Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure
Class: hydrolase
Keywords: alpha-alpha six fold, glycoside hydrolase, mannosidase, clostridium perfringens, hydrolase
Deposited on 2011-02-22, released 2011-03-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.163
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein CPE0426
    Species: Clostridium perfringens [TaxId:1502]
    Gene: CPE0426
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XNB2
      • engineered mutation (158)
    Domains in SCOPe 2.03: d3qt3a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qt3A (A:)
    mslstnelkeivrkigkdlsgkiedkklqelfyncfintmdttvevsegdafvitgdipa
    mwlrdstsqvehylpfvkeypelkaiftglinrqvkcifidpyanafnkepngqkwdndi
    tkdspwvwerkyeidslcypvrlihkywkesgdetffnydikkafnmiidlwrveqyhre
    ksdysfqrlncsvtdtlsheglgtpvtytgmtwsgfrpsddaceygylipanmfavvalr
    yiseiaekvykdeelkekadslreeidnaiekhgkvykegfgevyayetdgmgnynfmdd
    anvpsllsipyleykgiedevyqntrkfilsknnrfffegkaakgigsphtpdqyiwhia
    lsmqglttnnqeeidqlikllketdagtgymhegfhvddptkftrdwfawsnslfshfiy
    ekvinkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qt3A (A:)
    slstnelkeivrkigkdlsgkiedkklqelfyncfintmdttvevsegdafvitgdipam
    wlrdstsqvehylpfvkeypelkaiftglinrqvkcifidpyanafnkepngqkwdndit
    kdspwvwerkyeidslcypvrlihkywkesgdetffnydikkafnmiidlwrveqyhrek
    sdysfqrlncsvtdtlsheglgtpvtytgmtwsgfrpsddaceygylipanmfavvalry
    iseiaekvykdeelkekadslreeidnaiekhgkvykegfgevyayetdgmgnynfmdda
    nvpsllsipyleykgiedevyqntrkfilsknnrfffegkaakgigsphtpdqyiwhial
    smqglttnnqeeidqlikllketdagtgymhegfhvddptkftrdwfawsnslfshfiye
    kvink