PDB entry 3qt2

View 3qt2 on RCSB PDB site
Description: Structure of a cytokine ligand-receptor complex
Class: protein binding/immune system
Keywords: cytokine type I receptor fold, fibronectin type III modules, four-helical bundle, Cytokine, Ligand-receptor complex, membrane, PROTEIN BINDING-IMMUNE SYSTEM complex
Deposited on 2011-02-22, released 2012-02-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-5 receptor subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL5R, IL5RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01344
      • engineered mutation (67)
      • engineered mutation (73)
      • engineered mutation (139)
      • engineered mutation (168)
      • engineered mutation (235)
      • see remark 999 (314)
  • Chain 'B':
    Compound: Interleukin-5 receptor subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL5R, IL5RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01344
      • engineered mutation (67)
      • engineered mutation (73)
      • engineered mutation (139)
      • engineered mutation (168)
      • engineered mutation (235)
      • see remark 999 (314-315)
  • Chain 'C':
    Compound: Interleukin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: Il5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3qt2c_
  • Chain 'D':
    Compound: Interleukin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: Il5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3qt2d_
  • Chain 'E':
    Compound: Interleukin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: Il5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3qt2e_
  • Chain 'F':
    Compound: Interleukin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: Il5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3qt2f_
  • Heterogens: BGC, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qt2C (C:)
    maipteiptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesq
    tvqggtverlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewiies
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qt2C (C:)
    teiptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqg
    gtverlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qt2D (D:)
    maipteiptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesq
    tvqggtverlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewiies
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qt2D (D:)
    ptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggtv
    erlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewiie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qt2E (E:)
    maipteiptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesq
    tvqggtverlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewiies
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qt2E (E:)
    eiptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqgg
    tverlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3qt2F (F:)
    maipteiptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesq
    tvqggtverlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewiies
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qt2F (F:)
    ptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggtv
    erlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewiie