PDB entry 3qst

View 3qst on RCSB PDB site
Description: Crystal structure of Trichomonas vaginalis triosephosphate isomerase TVAG_096350 gene (Val-45 variant)
Class: isomerase
Keywords: TIM barrel, isomerase
Deposited on 2011-02-21, released 2012-07-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.159
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, putative
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_096350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3qsta_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qstA (A:)
    gphmrtffvggnwkanpktvqeaeklvemlngakvegnvevvvaapfvflptlqqklrkd
    wkvsaenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfale
    ngmkiiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkva
    stqdaqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggasl
    eagfinivnsnvhsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qstA (A:)
    rtffvggnwkanpktvqeaeklvemlngakvegnvevvvaapfvflptlqqklrkdwkvs
    aenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengmk
    iiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastqd
    aqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggasleagf
    inivnsnvhsk