PDB entry 3qsr

View 3qsr on RCSB PDB site
Description: Crystal structure of Trichomonas vaginalis triosephosphate isomerase TVAG_497370 gene (Ile-45 variant)
Class: isomerase
Keywords: TIM barrel, isomerase
Deposited on 2011-02-21, released 2012-07-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_497370
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3qsra_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qsrA (A:)
    gphmrtffvggnwkanpktveeaekliemlngakvegnvevvvaapfiflptlqqklrkd
    wkvsaenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfale
    ngmkiiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkva
    stqdaqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggasl
    epgfinivnsnvhsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qsrA (A:)
    mrtffvggnwkanpktveeaekliemlngakvegnvevvvaapfiflptlqqklrkdwkv
    saenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengm
    kiiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastq
    daqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggaslepg
    finivnsnvhs