PDB entry 3qsd

View 3qsd on RCSB PDB site
Description: Structure of cathepsin B1 from Schistosoma mansoni in complex with CA074 inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: cysteine peptidase, digestive tract, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-02-21, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.116
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin B-like peptidase (C01 family)
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: cb1.1, Smp_103610
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MNY2 (Start-253)
      • engineered mutation (98)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d3qsda_
  • Heterogens: 074, PEG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qsdA (A:)
    veipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavd
    llsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppc
    gskiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvye
    dflnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrd
    ecsiesevtagrin
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qsdA (A:)
    eipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavdl
    lsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppcg
    skiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvyed
    flnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrde
    csiesevtagrin