PDB entry 3qs6

View 3qs6 on RCSB PDB site
Description: Crystal structure of LeuT mutant F259V,I359Q bound to sodium and L-tryptophan
Class: transport protein
Keywords: NSS, neurotransmitter transporter, LeuT-fold, sodium-coupled secondary transporter, sodium and amino acid binding, membrane, TRANSPORT PROTEIN
Deposited on 2011-02-19, released 2011-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Na(+):neurotransmitter symporter (Snf family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: aq_2077, LeuT, snf
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67854 (Start-512)
      • engineered mutation (258)
      • engineered mutation (358)
      • expression tag (513-514)
    Domains in SCOPe 2.08: d3qs6a1, d3qs6a2
  • Heterogens: TRP, NA, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qs6A (A:)
    mevkrehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmw
    iewamgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfai
    kflvglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinv
    silirgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkd
    pgvwiaavgqifftlslgvgaiityasyvrkdqdivlsgltaatlnekaevilggsisip
    aavaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaqm
    qpmiafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffgltel
    iiffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeeth
    wtvwitrfyiiglflfltflvflaerrrnhesagtlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qs6A (A:)
    rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
    mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
    glvpeppptdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirg
    iskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwia
    avgqifftlslgvgaiityasyvrkdqdivlsgltaatlnekaevilggsisipaavaff
    gvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaqmqpmiaf
    ledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwi
    fgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvwit
    rfyiiglflfltflvflaerrrnhesagt