PDB entry 3qs4

View 3qs4 on RCSB PDB site
Description: Crystal structure of LeuT mutant F259V bound to sodium and L-tryptophan
Class: transport protein
Keywords: NSS, neurotransmitter transporter, LeuT-fold, sodium-coupled secondary transporter, sodium and amino acid binding, membrane, TRANSPORT PROTEIN
Deposited on 2011-02-19, released 2011-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.215
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Na(+):neurotransmitter symporter (Snf family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: aq_2077, LeuT, snf
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67854
      • engineered mutation (258)
    Domains in SCOPe 2.07: d3qs4a_
  • Heterogens: TRP, BOG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qs4A (A:)
    mevkrehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmw
    iewamgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfai
    kflvglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinv
    silirgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkd
    pgvwiaavgqifftlslgvgaiityasyvrkdqdivlsgltaatlnekaevilggsisip
    aavaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaim
    qpmiafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffgltel
    iiffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeeth
    wtvwitrfyiiglflfltflvflaerrrnhesagtlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qs4A (A:)
    rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
    mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
    glvpepptdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirgi
    skgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwiaa
    vgqifftlslgvgaiityasyvrkdqdivlsgltaatlnekaevilggsisipaavaffg
    vanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmiafl
    edelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwif
    gadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvwitr
    fyiiglflfltflvflaerrrnhe