PDB entry 3qry

View 3qry on RCSB PDB site
Description: Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex
Class: hydrolase
Keywords: alpha-alpha six fold, glycoside hydrolase, mannosidase, 1-deoxymannojirimycin, hydrolase
Deposited on 2011-02-18, released 2011-03-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.172
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: SP_2144
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qrya_
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: SP_2144
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qryb_
  • Heterogens: DMJ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qryA (A:)
    mvyskeivrewldevaerakdypewvdvfercytdtldntveiledgstfvltgdipamw
    lrdstaqlrpylhvakrdallrqtiaglvkrqmtlvlkdpyansfnieenwkghhetdht
    dlngwiwerkyevdslcyplqlayllwketgetsqfdeifvaatkeilhlwtveqdhkns
    pyrfvrdtdrkedtlvndgfgpdfavtgmtwsafrpsddccqysylipsnmfavvvlgyv
    qeifaalnladsqsviadakrlqdeiqegiknyayttnskgekiyafevdglgnasimdd
    pnvpsllaapylgycsvddevyqatrrtilssenpyfyqgeyasglgsshtfyryiwpia
    lsiqglttrdkaekkflldqlvacdggtgvmhesfhvddptlysrewfswanmmfcelvl
    dyldir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qryB (B:)
    mvyskeivrewldevaerakdypewvdvfercytdtldntveiledgstfvltgdipamw
    lrdstaqlrpylhvakrdallrqtiaglvkrqmtlvlkdpyansfnieenwkghhetdht
    dlngwiwerkyevdslcyplqlayllwketgetsqfdeifvaatkeilhlwtveqdhkns
    pyrfvrdtdrkedtlvndgfgpdfavtgmtwsafrpsddccqysylipsnmfavvvlgyv
    qeifaalnladsqsviadakrlqdeiqegiknyayttnskgekiyafevdglgnasimdd
    pnvpsllaapylgycsvddevyqatrrtilssenpyfyqgeyasglgsshtfyryiwpia
    lsiqglttrdkaekkflldqlvacdggtgvmhesfhvddptlysrewfswanmmfcelvl
    dyldir