PDB entry 3qrk

View 3qrk on RCSB PDB site
Description: The crystal structure of human abl1 kinase domain in complex with DP-987
Class: transferase/transferase inhibitor
Keywords: ABL1, KINASE, KINASE DOMAIN, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-02-18, released 2011-06-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.05: d3qrka_
  • Heterogens: 9DP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qrkA (A:)
    tsmdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qrkA (A:)
    psspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflke
    aavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatq
    issameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwt
    apeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpe
    kvyelmracwqwnpsdrpsfaeihqafetm