PDB entry 3qrg

View 3qrg on RCSB PDB site
Description: Crystal structure of antiRSVF Fab B21m
Class: immune system
Keywords: Fab structure, RSV, IMMUNE SYSTEM
Deposited on 2011-02-17, released 2011-08-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain Fd fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QRG (0-End)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QRG (0-End)
    Domains in SCOPe 2.04: d3qrgl1, d3qrgl2
  • Heterogens: GOL, SO4, BTB, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3qrgL (L:)
    divmtqspdslavslgeratincrasqsvdyngisymhwyqqkpgqppklliyaasnpes
    gvpdrfsgsgsgtdftltisslqaedvavyycqqiiedpwtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qrgL (L:)
    divmtqspdslavslgeratincrasqsvdyngisymhwyqqkpgqppklliyaasnpes
    gvpdrfsgsgsgtdftltisslqaedvavyycqqiiedpwtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge