PDB entry 3qrf

View 3qrf on RCSB PDB site
Description: Structure of a domain-swapped FOXP3 dimer
Class: DNA binding protein/DNA
Keywords: Beta Barrel, Domain Swap, Forkhead Domain, Immnoglobulin Fold, Protein-DNA Complex, Double Helix, Transcription Regulation, DNA Binding, Nucleus, DNA BINDING PROTEIN-DNA complex
Deposited on 2011-02-17, released 2011-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human hARRE2 DNA (Plus Strand)
  Species: synthetic, synthetic
  
• Chain 'B':
  Compound: human hARRE2 DNA (Minus Strand)
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: human hARRE2 DNA (Plus Strand)
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: human hARRE2 DNA (Minus Strand)
  Species: synthetic, synthetic
  
• Chain 'F':
  Compound: Forkhead box protein P3
  Species: Homo sapiens [TaxId:9606]
  Gene: FOXP3, IPEX, JM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BZS1 (0-81)
  Domains in SCOPe 2.08: d3qrff_
• Chain 'G':
  Compound: Forkhead box protein P3
  Species: Homo sapiens [TaxId:9606]
  Gene: FOXP3, IPEX, JM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BZS1 (0-81)
  Domains in SCOPe 2.08: d3qrfg_
• Chain 'H':
  Compound: Forkhead box protein P3
  Species: Homo sapiens [TaxId:9606]
  Gene: FOXP3, IPEX, JM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BZS1 (0-81)
  Domains in SCOPe 2.08: d3qrfh_
• Chain 'I':
  Compound: Forkhead box protein P3
  Species: Homo sapiens [TaxId:9606]
  Gene: FOXP3, IPEX, JM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BZS1 (0-81)
  Domains in SCOPe 2.08: d3qrfi_
• Chain 'M':
  Compound: Nuclear factor of activated T-cells, cytoplasmic 2
  Species: Homo sapiens [TaxId:9606]
  Gene: NFATC2, NFAT1, NFATP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13469 (3-285)
    • expression tag (0-2)
    • conflict (236-241)
• Chain 'N':
  Compound: Nuclear factor of activated T-cells, cytoplasmic 2
  Species: Homo sapiens [TaxId:9606]
  Gene: NFATC2, NFAT1, NFATP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13469 (3-285)
    • expression tag (0-2)
    • conflict (236-241)
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qrfF (F:)
  mrppftyatlirwaileapekqrtlneiyhwftrmfaffrnhpatwknairhnlslhkcf
  vrvesekgavwtvdelefrkkr
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qrfG (G:)
  mrppftyatlirwaileapekqrtlneiyhwftrmfaffrnhpatwknairhnlslhkcf
  vrvesekgavwtvdelefrkkr
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qrfH (H:)
  mrppftyatlirwaileapekqrtlneiyhwftrmfaffrnhpatwknairhnlslhkcf
  vrvesekgavwtvdelefrkkr
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qrfI (I:)
  mrppftyatlirwaileapekqrtlneiyhwftrmfaffrnhpatwknairhnlslhkcf
  vrvesekgavwtvdelefrkkr
  

  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.