PDB entry 3qrc

View 3qrc on RCSB PDB site
Description: The crystal structure of Ail, the attachment invasion locus protein of Yersinia pestis, in complex with the heparin analogue sucrose octasulfate
Class: cell invasion
Keywords: beta-barrel protein, attachment and invasion virulence, laminin, heparin, CELL INVASION
Deposited on 2011-02-17, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.204
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Attachment invasion locus protein
    Species: Yersinia pestis [TaxId:632]
    Gene: ail, YPO2905
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0WCZ9 (1-156)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3qrca_
  • Chain 'B':
    Compound: Attachment invasion locus protein
    Species: Yersinia pestis [TaxId:632]
    Gene: ail, YPO2905
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0WCZ9 (1-156)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3qrcb_
  • Heterogens: SCR, C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qrcA (A:)
    megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvd
    gfklidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslayga
    glqfnphpnfvidasyeysklddvkvgtwmlgagyrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qrcA (A:)
    megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvl
    idgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslaygaglqf
    nphpnfvidasyeysklddvkvgtwmlgagyrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qrcB (B:)
    megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvd
    gfklidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslayga
    glqfnphpnfvidasyeysklddvkvgtwmlgagyrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qrcB (B:)
    megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvd
    lidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslaygaglq
    fnphpnfvidasyeysklddvkvgtwmlgagyrf