PDB entry 3qr6

View 3qr6 on RCSB PDB site
Description: Crystal Structure Analysis of H185F Mutant of Human CLIC1
Class: transport protein
Keywords: CLIC, pH sensor, Thioredoxin, GST superfamily, Ion channel, glutathione, cytosol, membrane, TRANSPORT PROTEIN
Deposited on 2011-02-17, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.205
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, G6, NCC27
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299 (Start-240)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d3qr6a1, d3qr6a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qr6A (A:)
    maeeqpqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcp
    ggqlpfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayikn
    snpalndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnl
    lpklfivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakal
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qr6A (A:)
    pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggqlp
    fllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayiknsnpal
    ndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnllpklf
    ivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakalk