PDB entry 3qr3

View 3qr3 on RCSB PDB site
Description: Crystal Structure of Cel5A (EG2) from Hypocrea jecorina (Trichoderma reesei)
Class: hydrolase
Keywords: Tim Barrel, Endoglucanase, Hydrolase
Deposited on 2011-02-16, released 2011-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.165
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase EG-II
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: Cel5A, egl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07982 (1-327)
      • expression tag (0)
      • expression tag (328)
    Domains in SCOPe 2.06: d3qr3a1, d3qr3a2, d3qr3a3
  • Chain 'B':
    Compound: Endoglucanase EG-II
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: Cel5A, egl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07982 (1-327)
      • expression tag (0)
      • expression tag (328)
    Domains in SCOPe 2.06: d3qr3b1, d3qr3b2, d3qr3b3
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qr3A (A:)
    mgvrfagvniagfdfgcttdgtcvtskvypplknftgsnnypdgigqmqhfvnedgmtif
    rlpvgwqylvnnnlggnldstsiskydqlvqgclslgaycivdihnyarwnggiigqggp
    tnaqftslwsqlaskyasqsrvwfgimnephdvnintwaatvqevvtairnagatsqfis
    lpgndwqsagafisdgsaaalsqvtnpdgsttnlifdvhkyldsdnsgthaecttnnidg
    afsplatwlrqnnrqailtetgggnvqsciqdmcqqiqylnqnsdvylgyvgwgagsfds
    tyvltetptssgnswtdtslvssclarkggsgsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qr3A (A:)
    mgvrfagvniagfdfgcttdgtcvtskvypplknftgsnnypdgigqmqhfvnedgmtif
    rlpvgwqylvnnnlggnldstsiskydqlvqgclslgaycivdihnyarwnggiigqggp
    tnaqftslwsqlaskyasqsrvwfgimnephdvnintwaatvqevvtairnagatsqfis
    lpgndwqsagafisdgsaaalsqvtnpdgsttnlifdvhkyldsdnsgthaecttnnidg
    afsplatwlrqnnrqailtetgggnvqsciqdmcqqiqylnqnsdvylgyvgwgagsfds
    tyvltetptssgnswtdtslvssclarkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qr3B (B:)
    mgvrfagvniagfdfgcttdgtcvtskvypplknftgsnnypdgigqmqhfvnedgmtif
    rlpvgwqylvnnnlggnldstsiskydqlvqgclslgaycivdihnyarwnggiigqggp
    tnaqftslwsqlaskyasqsrvwfgimnephdvnintwaatvqevvtairnagatsqfis
    lpgndwqsagafisdgsaaalsqvtnpdgsttnlifdvhkyldsdnsgthaecttnnidg
    afsplatwlrqnnrqailtetgggnvqsciqdmcqqiqylnqnsdvylgyvgwgagsfds
    tyvltetptssgnswtdtslvssclarkggsgsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qr3B (B:)
    mgvrfagvniagfdfgcttdgtcvtskvypplknftgsnnypdgigqmqhfvnedgmtif
    rlpvgwqylvnnnlggnldstsiskydqlvqgclslgaycivdihnyarwnggiigqggp
    tnaqftslwsqlaskyasqsrvwfgimnephdvnintwaatvqevvtairnagatsqfis
    lpgndwqsagafisdgsaaalsqvtnpdgsttnlifdvhkyldsdnsgthaecttnnidg
    afsplatwlrqnnrqailtetgggnvqsciqdmcqqiqylnqnsdvylgyvgwgagsfds
    tyvltetptssgnswtdtslvssclarkg