PDB entry 3qqt

View 3qqt on RCSB PDB site
Description: Amphiphilic nanotubes in the crystal structure of a biosurfactant protein hydrophobin HFBII
Class: structural protein
Keywords: Surface active protein, amphiphile, STRUCTURAL PROTEIN
Deposited on 2011-02-16, released 2011-11-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrophobin-2
    Species: TRICHODERMA REESEI [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qqta_
  • Chain 'B':
    Compound: Hydrophobin-2
    Species: TRICHODERMA REESEI [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qqtb_
  • Heterogens: SO4, SDS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qqtA (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qqtA (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qqtB (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qqtB (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigt