PDB entry 3qqe

View 3qqe on RCSB PDB site
Description: Crystal structure of HA2 R106H mutant of H2 hemagglutinin, re-neutralized form
Class: viral protein
Keywords: viral envelope protein, hemagglutinin, viral fusion protein, viral protein
Deposited on 2011-02-15, released 2011-03-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:387161]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7S226 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.05: d3qqea_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:387161]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7S226 (0-End)
      • engineered mutation (105)
    Domains in SCOPe 2.05: d3qqeb_
  • Heterogens: NAG, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qqeA (A:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpqiesr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qqeA (A:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpkyvkseklvlatglrnvpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qqeB (B:)
    glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
    tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenehtldfhdsnvknlyd
    kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrneik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qqeB (B:)
    glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
    tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenehtldfhdsnvknlyd
    kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne