PDB entry 3qq8

View 3qq8 on RCSB PDB site
Description: Crystal structure of p97-N in complex with FAF1-UBX
Class: transport protein/apoptosis
Keywords: beta-barrel, beta-grasp, ATPase, ubiquitin, phosphorylation, TRANSPORT PROTEIN-APOPTOSIS complex
Deposited on 2011-02-15, released 2011-06-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: fas-associated factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FAF1, UBXD12, UBXN3A, CGI-03
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3qq8b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qq8B (B:)
    msenaepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvt
    qldpnksllevklfpqetlfleake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qq8B (B:)
    aepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldp
    nksllevklfpqetlfleak