PDB entry 3qq7

View 3qq7 on RCSB PDB site
Description: Crystal Structure of the p97 N-terminal domain
Class: transport protein
Keywords: beta-barrel, ATPase, ubiquitin, phosphorylation, TRANSPORT PROTEIN
Deposited on 2011-02-15, released 2011-06-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.197
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qq7a1, d3qq7a2
  • Heterogens: HEZ, GOL, CO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qq7A (A:)
    asgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkg
    kkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpidd
    tvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdtv
    ihcege
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qq7A (A:)
    knrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsd
    ekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyf
    leayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcege