PDB entry 3qq4

View 3qq4 on RCSB PDB site
Description: Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides
Class: immune system
Keywords: Swine MHC Class 1, SLA-1*0401, Epitope of Ebola virus, IMMUNE SYSTEM
Deposited on 2011-02-15, released 2011-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Sus scrofa [TaxId:9823]
    Gene: PD1, SLA-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Sus scrofa [TaxId:9823]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07717 (2-99)
      • expression tag (1)
    Domains in SCOPe 2.08: d3qq4b1, d3qq4b2
  • Chain 'C':
    Compound: vp35
    Species: Sudan ebolavirus, synthetic [TaxId:186540]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3qq4B (B:)
efvarppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskd
wsfyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh

    Sequence, based on observed residues (ATOM records): (download) 
    >3qq4B (B:)
fvarppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskdw
sfyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh

  • Chain 'C':
    No sequence available.