PDB entry 3qq3
View 3qq3 on RCSB PDB site
Description: Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides
Class: immune system
Keywords: Swine MHC Class 1, SLA-1*0401, Epitope of Influenza virus, IMMUNE SYSTEM
Deposited on
2011-02-15, released
2011-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-12-28, with a file datestamp of
2011-12-23.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.203
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: MHC class I antigen
Species: Sus scrofa [TaxId:9823]
Gene: PD1, SLA-1
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Beta-2-microglobulin
Species: Sus scrofa [TaxId:9823]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d3qq3b_ - Chain 'C':
Compound: 9-mer peptide from Neuraminidase
Species: Influenza A virus, synthetic [TaxId:11320]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: MHC class I antigen
Species: Sus scrofa [TaxId:9823]
Gene: PD1, SLA-1
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Beta-2-microglobulin
Species: Sus scrofa [TaxId:9823]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d3qq3e_ - Chain 'F':
Compound: 9-mer peptide from Neuraminidase
Species: Influenza A virus, synthetic [TaxId:11320]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3qq3B (B:)
efvarppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskd
wsfyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh
Sequence, based on observed residues (ATOM records): (download)
>3qq3B (B:)
fvarppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskdw
sfyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence, based on SEQRES records: (download)
>3qq3E (E:)
efvarppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskd
wsfyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh
Sequence, based on observed residues (ATOM records): (download)
>3qq3E (E:)
fvarppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskdw
sfyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh
- Chain 'F':
No sequence available.