PDB entry 3qpx

View 3qpx on RCSB PDB site
Description: Crystal structure of Fab C2507
Class: immune system
Keywords: immunoglobulin, immune system, mouse IL-17A
Deposited on 2011-02-14, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.227
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab C2507 heavy chain
    Species: Homo sapiens, Rattus norvegicus [TaxId:9606, 10116]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QPX (0-227)
  • Chain 'L':
    Compound: Fab C2507 light chain
    Species: Homo sapiens, Rattus norvegicus [TaxId:9606, 10116]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QPX (0-212)
    Domains in SCOPe 2.07: d3qpxl1, d3qpxl2
  • Heterogens: SO4, GOL, CD, CL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3qpxL (L:)
diqmtqspsllsasvgdrvtlsckasqniynylnwyqqklgeapklliyytdrlqtgips
rfsgdgsgsdytltisslqpedvatyfcqqynsrdtfgagtkldlkrtvaapsvfifpps
deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
skadyekhkvyacevthqglsspvtksfnrgec