PDB entry 3qpx

View 3qpx on RCSB PDB site
Description: Crystal structure of Fab C2507
Class: immune system
Keywords: immunoglobulin, immune system, mouse IL-17A
Deposited on 2011-02-14, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.227
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: Fab C2507 heavy chain
  Species: Homo sapiens, Rattus norvegicus [TaxId:9606, 10116]
  Database cross-references and differences (RAF-indexed):
  • PDB 3QPX (0-227)
• Chain 'L':
  Compound: Fab C2507 light chain
  Species: Homo sapiens, Rattus norvegicus [TaxId:9606, 10116]
  Database cross-references and differences (RAF-indexed):
  • PDB 3QPX (0-212)
  Domains in SCOPe 2.07: d3qpxl1, d3qpxl2
• Heterogens: SO4, GOL, CD, CL, HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qpxL (L:)
  diqmtqspsllsasvgdrvtlsckasqniynylnwyqqklgeapklliyytdrlqtgips
  rfsgdgsgsdytltisslqpedvatyfcqqynsrdtfgagtkldlkrtvaapsvfifpps
  deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
  skadyekhkvyacevthqglsspvtksfnrgec