PDB entry 3qpq

View 3qpq on RCSB PDB site
Description: Crystal structure of ANTI-TLR3 antibody C1068 FAB
Class: immune system
Keywords: immunoglobulin fold, immune system, tlr-3
Deposited on 2011-02-14, released 2011-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: C1068 light chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QPQ (0-214)
    Domains in SCOPe 2.06: d3qpqc1, d3qpqc2
  • Chain 'D':
    Compound: C1068 heavy chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QPQ (0-End)
  • Chain 'E':
    Compound: C1068 light chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QPQ (0-214)
    Domains in SCOPe 2.06: d3qpqe1, d3qpqe2
  • Chain 'F':
    Compound: C1068 heavy chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QPQ (0-222)
  • Chain 'H':
    Compound: C1068 heavy chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QPQ (0-End)
  • Chain 'I':
    Compound: C1068 light chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QPQ (0-214)
    Domains in SCOPe 2.06: d3qpqi1, d3qpqi2
  • Chain 'J':
    Compound: C1068 heavy chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QPQ (0-End)
  • Chain 'L':
    Compound: C1068 light chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QPQ (0-214)
    Domains in SCOPe 2.06: d3qpql1, d3qpql2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qpqC (C:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsesgtqyslkinslqpedfgsyycqhfwstpftfgsgtklelkrgtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qpqE (E:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsesgtqyslkinslqpedfgsyycqhfwstpftfgsgtklelkrgtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qpqI (I:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsesgtqyslkinslqpedfgsyycqhfwstpftfgsgtklelkrgtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qpqL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsesgtqyslkinslqpedfgsyycqhfwstpftfgsgtklelkrgtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec