PDB entry 3qpj
View 3qpj on RCSB PDB site
Description: HIV-1 protease (mutant Q7K L33I L63I) in complex with a three-armed pyrrolidine-based inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Aspartyl Protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2011-02-14, released
2012-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated
2012-02-15, with a file datestamp of
2012-02-10.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.171
AEROSPACI score: 0.61
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
Domains in SCOPe 2.08: d3qpja_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
Domains in SCOPe 2.08: d3qpjb_ - Heterogens: CL, N4I, DTD, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3qpjA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3qpjB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf