PDB entry 3qpf

View 3qpf on RCSB PDB site
Description: Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure
Class: Hydrolase
Keywords: alpha-alpha six fold, Glycoside hydrolase, Mannosidase, Streptococcus pneumoniae, Hydrolase
Deposited on 2011-02-12, released 2011-03-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.159
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: SP_2144
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qpfa_
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: SP_2144
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qpfb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qpfA (A:)
    mvyskeivrewldevaerakdypewvdvfercytdtldntveiledgstfvltgdipamw
    lrdstaqlrpylhvakrdallrqtiaglvkrqmtlvlkdpyansfnieenwkghhetdht
    dlngwiwerkyevdslcyplqlayllwketgetsqfdeifvaatkeilhlwtveqdhkns
    pyrfvrdtdrkedtlvndgfgpdfavtgmtwsafrpsddccqysylipsnmfavvvlgyv
    qeifaalnladsqsviadakrlqdeiqegiknyayttnskgekiyafevdglgnasimdd
    pnvpsllaapylgycsvddevyqatrrtilssenpyfyqgeyasglgsshtfyryiwpia
    lsiqglttrdkaekkflldqlvacdggtgvmhesfhvddptlysrewfswanmmfcelvl
    dyldir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qpfB (B:)
    mvyskeivrewldevaerakdypewvdvfercytdtldntveiledgstfvltgdipamw
    lrdstaqlrpylhvakrdallrqtiaglvkrqmtlvlkdpyansfnieenwkghhetdht
    dlngwiwerkyevdslcyplqlayllwketgetsqfdeifvaatkeilhlwtveqdhkns
    pyrfvrdtdrkedtlvndgfgpdfavtgmtwsafrpsddccqysylipsnmfavvvlgyv
    qeifaalnladsqsviadakrlqdeiqegiknyayttnskgekiyafevdglgnasimdd
    pnvpsllaapylgycsvddevyqatrrtilssenpyfyqgeyasglgsshtfyryiwpia
    lsiqglttrdkaekkflldqlvacdggtgvmhesfhvddptlysrewfswanmmfcelvl
    dyldir