PDB entry 3qpd

View 3qpd on RCSB PDB site
Description: Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon
Class: hydrolase
Keywords: alpha-beta hydrolase fold, esterase, hydrolase, cutin, mono-ethyl phosphorylated serine residue, secreted, phosphorylated serine residue
Deposited on 2011-02-11, released 2012-02-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.161
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cutinase 1
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: cutL, AO090005000029
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3qpda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qpdA (A:)
    ltggdelrdgpckpitfifarastepgllgistgpavcnrlklarsgdvacqgvgpryta
    dlpsnalpegtsqaaiaeaqglfeqavskcpdtqivaggysqgtavmngaikrlsadvqd
    kikgvvlfgytrnaqergqianfpkdkvkvycavgdlvclgtlivapphfsylsdtgdas
    dfllsql