PDB entry 3qpc

View 3qpc on RCSB PDB site
Description: Structure of Fusarium Solani Cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon
Class: hydrolase
Keywords: alpha-beta hydrolase fold, esterase, hydrolase, cutin, mono-ethyl phosphorylated serine residue, secreted
Deposited on 2011-02-11, released 2012-02-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: 0.15
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: Fusarium solani [TaxId:169388]
    Gene: CUT1, CUTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3qpca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qpcA (A:)
    grttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgg
    ayratlgdnalprgtssaairemlglfqqantkcpdatliaggyxqgaalaaasiedlds
    airdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpda
    rgpapefliekvravrg