PDB entry 3qoz

View 3qoz on RCSB PDB site
Description: Structure of wild-type HIV protease in complex with darunavir
Class: Hydrolase/Hydrolase Inhibitor
Keywords: aspartic protease, viral protease, Hydrolase, Protease, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2011-02-11, released 2011-06-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus [TaxId:11686]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • conflict (36)
    • conflict (54)
  Domains in SCOPe 2.03: d3qoza_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus [TaxId:11686]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • conflict (36)
    • conflict (54)
  Domains in SCOPe 2.03: d3qozb_
• Heterogens: 017, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qozA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfirvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qozB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfirvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf