PDB entry 3qot

View 3qot on RCSB PDB site
Description: Crystal Structure of Human Germline Antibody 1-69/B3
Class: immune system
Keywords: immunoglobulin fold, monoclonal antibody, IMMUNE SYSTEM
Deposited on 2011-02-10, released 2011-08-10
Made obsolete by 5i18 on 2016-02-24

The last revision prior to the SCOPe 2.04 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 1-69 (IGHV1-69) heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QOT
  • Chain 'L':
    Compound: B3 (IGKV4-1) light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QOT (0-End)
    Domains in SCOPe 2.04: d3qotl1, d3qotl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3qotL (L:)
    mdivmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywast
    resgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgqgtkveikrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qotL (L:)
    mdivmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywast
    resgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgqgtkveikrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnrg