PDB entry 3qos

View 3qos on RCSB PDB site
Description: Crystal Structure of Human Germline Antibody 3-23/B3
Class: immune system
Keywords: immunoglobulin fold, monoclonal antibody, IMMUNE SYSTEM
Deposited on 2011-02-10, released 2011-06-08
Made obsolete by 5i1d on 2016-02-24

The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B3 (IGKV4-1) light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QOS (0-End)
    Domains in SCOPe 2.06: d3qosa1, d3qosa2
  • Chain 'B':
    Compound: 3-23 (IGHV3-23) heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QOS (0-End)
  • Chain 'H':
    Compound: 3-23 (IGHV3-23) heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QOS (0-End)
  • Chain 'L':
    Compound: B3 (IGKV4-1) light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QOS (0-219)
    Domains in SCOPe 2.06: d3qosl1, d3qosl2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qosA (A:)
    divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgqgtkveikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qosA (A:)
    divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgqgtkveikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qosL (L:)
    divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgqgtkveikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec