PDB entry 3qoj

View 3qoj on RCSB PDB site
Description: Cryogenic structure of Staphylococcal nuclease variant D+PHS/V23K
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, pdTp, HYDROLASE
Deposited on 2011-02-10, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (22)
      • engineered mutation (43-44)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d3qoja_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qojA (A:)
    atstkklhkepatlikaidgdtkklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qojA (A:)
    lhkepatlikaidgdtkklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws