PDB entry 3qob

View 3qob on RCSB PDB site
Description: Mechanical Coupling Controls Cooperative Ligand Binding in a Homodimeric Hemoglobin
Class: oxygen transport
Keywords: time-resolved, Laue diffraction, dynamic crystallography, heterogeneous structure, OXYGEN TRANSPORT
Deposited on 2011-02-09, released 2020-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-06-03, with a file datestamp of 2020-05-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Globin-1
    Species: Anadara inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02213 (Start-145)
      • conflict (55)
    Domains in SCOPe 2.07: d3qoba_
  • Chain 'B':
    Compound: Globin-1
    Species: Anadara inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02213 (Start-145)
      • conflict (55)
    Domains in SCOPe 2.07: d3qobb_
  • Heterogens: HEM, CMO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qobA (A:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqg
    mandklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qobA (A:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
    andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qobB (B:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqg
    mandklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qobB (B:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
    andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal