PDB entry 3qoa

View 3qoa on RCSB PDB site
Description: Crystal structure of a human cytochrome P450 2B6 (Y226H/K262R) in complex with the inhibitor 4-Benzylpyridine.
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: P450, CYTOCHROME P450 2B6, MONOOXYGENASE, MEMBRANE PROTEIN, CYP2B6, ENDOPLASMIC RETICULUM, HEME, IRON, MEMBRANE, METAL BINDING, MIRCOSOME, PHOSPHOPROTEIN, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2011-02-09, released 2011-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2B6
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2B6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20813 (Start-471)
      • engineered mutation (8-9)
      • engineered mutation (206)
      • engineered mutation (242)
      • expression tag (472)
    Domains in SCOPe 2.08: d3qoaa1, d3qoaa2
  • Heterogens: HEM, CM5, 3QO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qoaA (A:)
    makktsskgklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlc
    gveairealvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgk
    rsveeriqeeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkml
    nlfyqtfslissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldps
    aprdlidtyllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyph
    vaervyreieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrg
    yiipkdtevflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclge
    giaraelflffttilqnfsmaspvapedidltpqecgvgkipptyqirflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qoaA (A:)
    gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
    lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdrsveeriqeeaqc
    lieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfslissv
    fgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidtyllhm
    ekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyreieqvi
    gphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdtevflil
    stalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelflfftt
    ilqnfsmaspvapedidltpqecgvgkipptyqirflprh