PDB entry 3qo1

View 3qo1 on RCSB PDB site
Description: Monoclinic form of IgG1 Fab fragment (apo form) sharing same Fv as IgA
Class: immune system
Keywords: immunoglobulin fold, antibody, serum, IMMUNE SYSTEM
Deposited on 2011-02-09, released 2012-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.169
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QO1 (0-218)
    Domains in SCOPe 2.06: d3qo1a1, d3qo1a2
  • Chain 'B':
    Compound: Fab fragment of IMMUNOGLOBULIN G1 HEAVY CHAIN
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QO1 (Start-219)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qo1A (A:)
    divmtqsplslsvtpgepasiscrssqsllrrdghndlewylqkpgqspqpliylgstra
    sgvpdrfsgsgsgtdftlkiirveaedagtyycmqnkqtpltfgqgtrleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.