PDB entry 3qny

View 3qny on RCSB PDB site
Description: Monoclinic form of human IgA1 Fab fragment, sharing same Fv as IgG
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2011-02-09, released 2012-02-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab fragment of immunoglobulin a1 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QNY (Start-218)
    Domains in SCOPe 2.05: d3qnya1, d3qnya2
  • Chain 'B':
    Compound: fab fragment of immunoglobulin a1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QNY (Start-220)
    Domains in SCOPe 2.05: d3qnyb1, d3qnyb2
  • Chain 'C':
    Compound: fab fragment of immunoglobulin a1 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QNY (0-218)
    Domains in SCOPe 2.05: d3qnyc1, d3qnyc2
  • Chain 'D':
    Compound: fab fragment of immunoglobulin a1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QNY (Start-220)
    Domains in SCOPe 2.05: d3qnyd1, d3qnyd2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qnyA (A:)
    divmtqsplslsvtpgepasiscrssqsllrrdghndlewylqkpgqspqpliylgstra
    sgvpdrfsgsgsgtdftlkiirveaedagtyycmqnkqtpltfgqgtrleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qnyA (A:)
    ivmtqsplslsvtpgepasiscrssqsllrrdghndlewylqkpgqspqpliylgstras
    gvpdrfsgsgsgtdftlkiirveaedagtyycmqnkqtpltfgqgtrleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qnyB (B:)
    evqlvesggglvqpggslklscaasgftlsgsnvhwvrqasgkglewvgrikrnaesdat
    ayaasmrgrltisrddskntaflqmnslksddtamyycvirgdvynrqwgqgtlvtvssa
    sptspkvfplslcstqpdgnvviaclvqgffpqeplsvtwsesgqgvtarnfppsqdasg
    dlyttssqltlpatqclagksvtchvkhytnpsqdvtvpcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qnyB (B:)
    qlvesggglvqpggslklscaasgftlsgsnvhwvrqasgkglewvgrikrnaesdatay
    aasmrgrltisrddskntaflqmnslksddtamyycvirqwgqgtlvtvssasptspkvf
    plslcstqpdgnvviaclvqgffpqeplsvtwsesgqgvtarnfppsqdasgdlyttssq
    ltlpatqclagksvtchvkhytnpsqdvtvpcp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qnyC (C:)
    divmtqsplslsvtpgepasiscrssqsllrrdghndlewylqkpgqspqpliylgstra
    sgvpdrfsgsgsgtdftlkiirveaedagtyycmqnkqtpltfgqgtrleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qnyD (D:)
    evqlvesggglvqpggslklscaasgftlsgsnvhwvrqasgkglewvgrikrnaesdat
    ayaasmrgrltisrddskntaflqmnslksddtamyycvirgdvynrqwgqgtlvtvssa
    sptspkvfplslcstqpdgnvviaclvqgffpqeplsvtwsesgqgvtarnfppsqdasg
    dlyttssqltlpatqclagksvtchvkhytnpsqdvtvpcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qnyD (D:)
    lvesggglvqpggslklscaasgftlsgsnvhwvrqasgkglewvgrikrnaesdataya
    asmrgrltisrddskntaflqmnslksddtamyycvirqwgqgtlvtvssasptspkvfp
    lslcqpdgnvviaclvqgffpqeplsvtwsesgqgvtarnfppsqdasgdlyttssqltl
    patqclagksvtchvkhytnpsqdvtvpcp